TCDB is operated by the Saier Lab Bioinformatics Group
>Q6GHV7|ISDB_STAAR Iron-regulated surface determinant protein B - Staphylococcus aureus (strain MRSA252).
MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAKAAEETGVTNTEAQPKTEAVASPTTTTTEKAPEAKPVAKPVA
NAVSVSNKEVVAPTTETKEAKEVKAVKEVKAPKEAKEEKPAAKADNNTYPILNQELREAIKNPAIKDKDHSAPNSRPIDF
EMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKA
VKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQDKLPEKLKAEYKKK
LEETKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNESMMDAFVKHPIKTGMLNGKKYMVMETTNDDYWK
DFMVEGQRVRTISKDAKNNTRTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANADKTNKKEQQDNSAK
KETTPAMPSKPTTPPVEKESQKQDSQKDDNKQSPSVEKENDASSESGKDKMPVTKPAKAEVESSSTTPTKVVSTTQNVAK
PTTASSETTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNKNTQENKAKSLPQTGEESNKDMTLPLMALIALSS
IVAFVLPRKRKN