TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=1 SV=1
MERSISFNPRGDNELPDDRSSDVGYAANDRRLAYSRSFQQSHGPRTPAVTEAAKPFLDRTVSSIDMPPDIYSVDGSDVFF
GEGKDVDMAKVSVLEMVWEVFGVVTSGNRQMKRLFLLIALNVLYSTTELSIGIFTGRVGLVSDAFHLTFGCGLLTFSLFA
MATSRKKPDHAYSYGYKRLEVLSAFTNALFLMFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLVNLLGVWFFRNYAR
VNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLGVENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIP
SSALSKCLRQITSREDVTEVLQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTDYT