TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6IT47|Q6IT47_PENCH Aromatic and neutral aliphatic amino acid permease - Penicillium chrysogenum (Penicillium notatum).
MGTEGEKAAYVPPPPFEGDMVGEMSEAERNIYDHGIKKFSRLGWKRLTIVLIVEAIALGSLSIPSTFATLGMVPGVLCCV
GIGLIAIYTSYIVGMVKLAFPEVANYADAGRLLGHRLGCGRFGYELVNGMLGLQLIFLTASHCLTGTIAFLDITKSGICS
IIFAVVSAIILLLLAVPPSFTEVAILGYVDFASIILAIGITIIGTGVEATNSPSGLSGVAWSAWPKDHLTFTEAFIAVTN
IIFAYSFAMCQFSFMDEMHTPRDFVKSIWTLGITEIVIYTVTGATIYAFVGQDVSSPALTSAGTTLSRVAYGVALPVIFI
SGSINTVVFGRLVHGRIFANSPIRFINTKMGWLTWLAVITAATIVAFIIAEVIPFFNDLLSISSALFISGFTFYFPAMMW
FMLLRKGSWKEPKNIILAVVNIMIFLIGMVVLVAGTYSSVDDIIIKYDKGEVGGVFSCAAPE