TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6J0P5|Q6J0P5_MAIZE Multidrug-resistance associated protein 3 - Zea mays (Maize).
MDIFGSPFCSKQAVASCGGWTDILDSSSCTNHILETGTAALITVALALHLLVVRITTKTRASARRPPVAPGLPLQLAGAA
FTACLGLVYLGLASWMLGSNFTQHASAYLPHWWVTALSQGLCLVLAGFALSGVGGARLLGPMSARAWSALLAAYAAFVAC
SSVVHMVADRALTMKGFLDALFLPGALLLVCGAWCVKEEDGDGGTGTAASLYKPLKTDDTVDDERGGSESHVTPFAKAGV
FSVMSFWWMNPMMKTGYEKPLEEKDMPLLGPSDRAYSQYLVFLEKLNRKKQLRAHGNPSMFWTIVSCQKTGILVSGLFAL
LKVLTLSSGPVLLKAFINVSLGKGSFKYEGYVLAVAMFLCKCCESLSQRQWYFRTRRLGLQVRSFLSAAVYKKHQRLSNS
AKLKHSSGEIMNYVTVDAYRIGEFPYWFHQTWTTSVQLCIALAILYDAVGLATVAALAVIIATVVCNAPLAKLQHKFQSR
LMEAQDVRLKAMSESLVHMKVLKLYAWETHFKKVIEGLREVEIKWLSAFQLRKAYNSFLFWTSPILVSAATFLACYLLKI
PLDASNVFTFVATLRLVQDPIRQIPDVIGVVIQAKVAFTRITKFLDAPELSGQVRKKSCLGDEYPIVMNCCSFSWDENPS
KPALKNVNLVVKTGQKVAICGEVGSGKSTLLAAVLGEVPKTEGTIQVCGKTAYVSQNAWIQTGTVQDNILFGSSMDRQRY
QETLERCSLVKDLEMLPYGDRTQIGERGINLSGGQKQRVQLARALYQNADIYLLDDPFSAVDAHTATSLFSGYVMGALSD
KTVLLVTHQVDFLPVFDSILLMSDGQIIRSASYHDLLAYCQEFQNLVNAHKDTIGVSDLNRVPPHRENEILIKETIDVHG
SRYKESLKPSPTDQLIKTEEREMGDTGLKPYILYLRQNKGFFYASLGIISHIVFVCGQISQNSWMATNVENPDVSTLKLT
SVYIAIGIFSVFFLLFRSLAVVVLGVKTSRSLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDIPFGFMFSIG
AGINAYSNLGVLAVVTWQVLFVSLPMIVLAIRLQRYYLASSKELMRINGTTKSALANHLGKSIAGAITIRAFQEEDRFFE
KNLELVDKNAGPYFYNFAATEWLIQRLETMSAAVLSFSALIMALLPQGTFNPGFVGMALSYGLSLNISFVFSIQNQCQLA
SQIISVERVHQYMDIPSEAAEIIEENRPAPDWPQVGRVDLKDLKIRYRQDAPLVLHGITCSFHGGDKIGIVGRTGSGKTT
LIGALFRLVEPTGGKIIIDSIDITTIGLHDLRSRLGIIPQDPTLFQGTIRYNLDPLGQFSDQQIWEVLGKCQLLEAVQEK
EQGLDSLVVEDGSNWSMGQRQLFCLGRALLRRCRILVLDEATASIDNATDAILQKTIRTEFRDCTVITVAHRIPTVMDCD
MVLAMSDGKVVEYDKPTKLVETEGSLFRDLVKEYWSYTSN