TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6KI74|Q6KI74_MYCMO Putative uncharacterized protein OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=MMOB2160 PE=4 SV=1
MKNENFLKSILKVSLVLFGLFFSIFVIISFLNYSWVLGFLIGSGISYLNFWLKISFNKRFFTFLNTKRKAFKWVFIYYNF
FFVLQGLIIIGILFINSFANNFIFFQNRNLKIALAPINIFTCIFGLSLIMISTFIINIVSQKKSLKNSSNQLNGRNKNGK