TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MJ49|Q6MJ49_BDEBA Uncharacterized protein OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd2936 PE=4 SV=1
MRIGLGLLLLFNWLMIYTDLEILFGPDGIVSLQTAQQYGNPLRFSLFDYMPNTYKVTATLAFVHLLAVLALTFGAWTRTS
ILIAFITLISFHHRNGFIMNSADSVLRVFLFLLLFTPCADAFSVDRWRLRLKGKAPEVPAEKAPWALRMIQIQFCIIYIA
TVLFKIKGDRWVDGTAVYIATRLDDFVRFELPLLNSMVLIKCITWSTLLVEFALGTLVWVKELRYWVLLAGVGLHLGIEF
TMSIPVFEWAMIVVMISMVDSRDIERWIERLQEHRKATTNLPESAVS