TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MKL1|Q6MKL1_BDEBA Adventurous gliding motility protein R OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=aglR PE=3 SV=1
MKCYINEGVTMEFLTKMAVAFEHGGFWMWPILLIQVASIAIMIERAYALFVRRKITQFDFAMGFEESIRRGEMDAVISKS
QAAMATNPVARAIAAGATAARNLGGKEEIQGKMDEVLIQENAALDHRTGFLTMFGNVATLTGLLGTISGMISSFAAVAFA
NPAEKASLLSAGISEAMNATAYGLITAIPALVAYAILQNRANRLAEDLNQAGLKVYNWLSYSYEPMTSYNIKTSKSERAA
ELDA