TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6NE56|Q6NE56_9PROT Magnetosome protein MamN OS=Magnetospirillum gryphiswaldense GN=mamN PE=4 SV=1
MVGFITLAVFIATFAVIYRWAEGSHLAVLAGAAVLVVIGTISGTYTPRMAVQSIYFETLALIFGMAAISALLARSGVYAY
LAAGTAELSQGQGRWILVMMALVTYGISLASNSLITVAVVVPVTLTVCFRTGIDPVPVIIAEIIAANLGGSSTMIGDFPN
MILASAGKLHFNDFIGGMMPACLILLAVTFLFFEYRQGDWKKAEIPVDLAWVRGEQLRYSDIDHRLLRYGLIIFFITVIG
LVLAGPLKVRPGWIAFVAGLTALALGRFKDEEFFSACGGSDILFFGGLFVMVGALTSVGILDWAVAWLEGVTAGHDRVRA
ILLMWMAAGVTIFVGGGTSAAVFAPVAATLRLDGDGQAAWWALALGIMAGSCAALSGATAGALAMNQYSGFVKRHPELAS
AAAAGLQFTHREYVRWGLPLMGIFLVLSTVYIAVLAG