TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6P1H1|CYAC3_MOUSE Cytochrome b ascorbate-dependent protein 3 OS=Mus musculus GN=Cybasc3 PE=1 SV=1
MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWK
VLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFG
ACILSLSITSVISGINEKLFFVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHD
RE