TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6PFS3|Q6PFS3_DANRE Voltage-dependent calcium channel gamma subunit OS=Danio rerio GN=cacng2a PE=2 SV=1
MGVFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKIKTNNENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQI
DHFPEDTDYEADASEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKSRHNIILSAGILFVSAGLSNIIGMIVYISAN
AGDPSKSDSKKNSYSYGWSFYFGALSFIMAEMVGVLAVHMFIDRHRELRAGARAADYLQGSAITRIPSYRYRYRRRSRSS
SRSTDPSHSRDASPVGLKGFGALPSTEISMYTLTRGGDTLKGGHGTPTATYNSERDHNFLQVHNCIQKDLKDSSNTANRR
TTPV