TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6TMY3|Q6TMY3_SCHHA Nicotinic acetylcholine receptor alpha subunit OS=Schistosoma haematobium PE=2 SV=1
MLIMNSIIKLCFGLFMFIDVVLSGLYEKRLLKYLFDSSRPDAHNPIERPSANDTETLNVSVKFFLNQVMDVDEKNQVLTT
IIWMDLIWNDYHFLWNPKEFGNITTLNLPYTAVWRPDILLYNCADEKFDRTFPTNTIIKHDGTVQWMPPGLFKSTCNIDI
LWFPFDEQSCILKFGSWTYYGDQINFQLQCINASQPDCTQVGTVDLSEYSRNGEFHLSGSSVRRYAQRYECCDYDFVDVK
IAITLQRRALYYVFNLIVPCLLISGMALMVFMLPPDAGEKISLGVTILLSLTMFLQLVADKLPQTSEAIPLIGIYFSCTM
FMCSLSIVFTVLVLNYHHRSADCIAVPAWIRNIVNTYLAKLMCMEPPKRSQIIEVEDISSSISDNFMENYPNTKKSQNET
LIKGGARGEQQQQQEGGGGEEEDDEEGHIGAKTFVGWNYDTTNMMNSNINPVYMKKHLFTNSPICINGNLKTTTLPMINQ
SMNNIDYQLHNTVNERTPKNAIANVIDLDDDFRATARFGNTTTTTTNTTHTTTTTHTNNSNIFINMHEKQTILNNNTKLK
MNTDLLSSVTVTNQSLTVQSPYRLYNSVGNFNSKSVPLTPISTLEHVQNVFPDEFSDLSKNGVSFDRQIEPDPLSISIDL
LNLYKPDLEIIINELHFITKKLRDNEKESLISLEWKFAARVIDRFCLVIFSVCNIVVTFAILCSAPNLIASFMP