TCDB is operated by the Saier Lab Bioinformatics Group
>Q6UP30|Q6UP30_CHLRE NADH:ubiquinone oxidoreductase 13 kD-like subunit - Chlamydomonas reinhardtii.
MALQATSQLARHVISKTLGGAFATKAADVVPTFDWKKVPVPSTTAKDIPVTVKGATPAGDLRATSGLGLGDGIKNHTDKW
LDGDKKSPMEYINEVAPIKVKGLVVASYGSDDPALGCPVEYINLKGTSLENPAVCKYTGNRYYSDDWKGGAAHH