TCDB is operated by the Saier Lab Bioinformatics Group
>Q6UP31|Q6UP31_CHLRE NADH:ubiquinone oxidoreductase B17.2-like subunit - Chlamydomonas reinhardtii.
MSLSGYFSRLLEASGKKSVGSFFASWEFGKMLVDGNLAHNVLVRATGAGRLVGTDYNGNRYYENEEAAYGRRRWIVYKDK
FDYNPTTIPPEWHGWLNYINDYNPTNTQFKQPTYQIEASMTKTGTQTCYNPKGSWFSAKPRNWRKYESWTPANKSA