TCDB is operated by the Saier Lab Bioinformatics Group
>Q6V5B3|Q6V5B3_CARAS Nuclear division RFT1-like protein - Cardaminopsis arenosa (Sand rock-cress) (Arabidopsis arenosa).
MQLYAVQFHLFVTCVLFLSREGFRRACLRANIKRDGPGSEENVTRLLKVAWMTVPLGIAITIAACIFVLWWQNLSYSDTY
AQAILIHGFACLLELMAEPLYILSQTLVKLELRLFVEIAATFARCLTLWSLIVNQTNMEKGIVFALSQVAYGGSLFLGYW
AYFLISGALRSSDLFPFRPGNFMDFDNKLSNMCMLFTFQSFRKLILQEGEKLVLVWLDTPYNQAVYGIVDKLGNLVVRMV
FFPFEETSYTIFARFASGDYQERKKKLGIGLTEALKLVILIGLIFMAFGPSYSYSLIRLLYGEKWSDGEASLALQFYCLY
IIVLAMNGTSEAFLHAVGTENELKRSNDMLLVFSLIYVTLNILLIRSAGAIGLIMANSLNMIFRIIYSGKFIQRYFQGTS
SFSFRKCFPLGWQILILSSIITLISEKTILDRKNFWETFPLHFAIGFICFCLSAIVIYRRERVFIKRIIRFRDYNHDD