TCDB is operated by the Saier Lab Bioinformatics Group
>Q6V9B2|Q6V9B2_CHLRE NADH:ubiquinone oxidoreductase 51 kD subunit - Chlamydomonas reinhardtii.
MQRTGGLVSQLAGAQLTGALQELKTGVLRAFSTAAPAAGAPPPPPPPPAKTSFGGLKDEDRIFQNIYGRHDLSIKGAMSR
GDWYMTKEIIGKGRDWIIDQMKKSGLRGRGGAGFPSGLKWSFMPKASDSRPIYLVVNGDESEPGTCKDREIMRHEPHKLV
EGCLMAGVAMGARAGYIYIRGEFVQERRAVERAISEAYAKGFLGKNACGSGVDFDLMVHYGAGAYICGEETALIESLEGK
QGKPRLKPPFPAGVGLYGCPTTVTNVETVAVSPTILRRGPEWFSSFGRKNNAGTKLFCISGHVNRPVTVEEEMSIPLKEL
IERHAGGVRGGWDNLLAIIPGGSSVPLLPKKICDGVLMDFDALKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESC
GQCTPCREGTGWLYDIMTRMKKGDARLEEIDMLWEITKQIEGHTICALGDAAAWPVQGLIRHFRGEMEERIKSAGGKKKL
AATA