TCDB is operated by the Saier Lab Bioinformatics Group
>Q6V9B3|Q6V9B3_CHLRE NADH:ubiquinone oxidoreductase 24 kD subunit - Chlamydomonas reinhardtii.
MLSRALLLAGRLAATGQQQAASTSSRAVQPLGSLLQRCNFATNSTDIFNIHKDTPENNAATSFEFSEATLKVVNDIIARY
PPNYKQSAIIPVLDVTQQENGGWLSLAAMNRVAKLLDMAPIRVYEVATFYTMFNRTKIGKYHVQICGTTPCRLQGSQKIE
EAITKHLGIGIGQTTQDGLFTLGEMECMGACVNAPMVAIADYTKGVSGFEYIYYEDLTPKDIVNILDTIKKGGKPKPGSQ
YRLKAEPAGAVHGGEKWVPKDGETTLTGAPRAPYCRDLNATA