TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6YQR5|Q6YQR5_ONYPE Putative uncharacterized protein OS=Onion yellows phytoplasma GN=PAM308 PE=4 SV=1
MLNNQKNVLRKIIAISFLLFLAFGLELLSRYTINATIPCNYAFFRIELIFIILIGYLFGPKYGFWASLFYLLIHYVLEFS
FMEVLLHHIHENHNHSHDHENEHASKALIFLYRFFLPYIVCSFSGLFYQKNLNHLTKKTPIIITLVLISVVQIISSILFI
NLLQENFAKKTFLKWFIPSPSYSWSLNLIYSFSSVIVSNTIIGALFYLINLRLKDNMEFLYGFSKEN