TCDB is operated by the Saier Lab Bioinformatics Group
>Q72KX3|Q72KX3_THET2 Glucose transport system permease protein - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
MRDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVRFRQSVVNLIF
FTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMALSFVVTGTIWRWLLQPQGGVNVLPTLFGLPPLSFPWLATRE
QVLVFDWNRLPFYTALVVGLVLLYVAYTAYREGERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILA
AVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPT
DVPAIYMYLLAFRGNQFAKGAAIGILLLLLVAVVVVPYLATQLRKEVRR