TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q73JF3|Q73JF3_TREDE ABC transporter, ATP-binding protein OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2622 PE=3 SV=1
MVELKNVSFRYGSENVECKYASSLKSIDLTVKTGECVLLTGPSGCGKTTILRLINGLIPHFYPGALSGDILIDGGSVKER
ELYDTALIIGTVFQNPRTQFYNVDTTGELAFGCENRGLPEQEIYTRIDRTVAHFRMASLMDRNIFRLSDGEKQKIACASV
NVSEPKIILLDEPSANLDYTATLMLRELILRWKAEGKTIIAAEHRIAYLWDIIDRAVVLRDGEIVEEFTGNGKEELTQNQ
LTQMGLRTTVMESPAEMQMDSFREGDRPITLRNFHFAYHGEKKNIVDIPMLQIAAGQITAIVGANGAGKTSFLNCLCGLE
KRCKGTLEYEGKLYDSKSRKKLCFMVMQDTGNQLFTESVLDEVLISLKKGTANEKETAMEIIRNLDLADFADRHPQSLSG
GQKQRLAIACALASGRELLLLDEPTSGLDYAHMKETAALLEKLRSMGTTILVVTHDSELIRACCTRRITV