TCDB is operated by the Saier Lab Bioinformatics Group
>Q73MJ3|Q73MJ3_TREDE Permease domain protein - Treponema denticola.
MYFKMIMSSLLRRRSRMLVALMAIAIGSTVLSGLLTIYYDIPRQMGTVFRSYGANMIFLPSESDAKIKKEQIDKIKKEID
SGKLVGFAPYIYKPAKVNEQPYMIAATDLISAKNNSPYWLVRGQWPDKKKEVLIGHEISKAIGLSIGDNFIVNTPKPDGD
VTVNEFKVSGIVTTGGVEEEFIFMSLEDIKNIVGYNDAFDVIECSIDGNRDYLNLIAEKVSNDVKGITPRLVKRVTESQD
TVLSKLQALVWIVTIIVLFLTMICVTTTMMAVVVERRKEIGLKKALGASNKSVVIDFLGEAVMLGLMGGILGIGLGYLFA
NNVSISVFAREVSFPIRLAPFTVISSIVITIVASLFPVRATVDVDPALVLRGE