TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q745T8|Q745T8_THET2 Hypothetical conserved protein OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_P0219 PE=4 SV=1
MKKRRYASGQLGLTLVSESFGTYLAFFYLERLGLSAALYALARTVYALWDAVNDPLFGHLSDRTKTPWGRRRPWLLLGVP
LFLLAYLLVFWVPDWARSPAVLPYYFALAILLYETLATVVWTNHGALFPEMFRGLRERAEAAALKRGAELLGLILGIALA
PMVYARVGFFGMALLFAGLALLAFLYFFPGIREDPRAGSGLGLWASFRLVLANRAFWVVALVGLLFEFGRMALQTAIPFY
AKHALGLEEGATTFLFAAVFLAALPSALLWGRLAGAWGGKRAWRLAHLLMGLSALLLFLPQGLPAALLAGALVGAGFAGV
RVTGEVVMAKVIDLDVERTETRREGAYYSLVGLLGRAAGALVGLAFALLTPLFGYVSGENPGPNPEAAFRFLVAVVPGTA
ILLAYALTALFPHEVKE