TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q795M8|YUGO_BACSU Putative potassium channel protein yugO OS=Bacillus subtilis GN=yugO PE=4 SV=2
MKSNRIFISWLRWPLFIRIGVIILCLILLFGQIIYILEPKQFTSVFEGIWWAVVTVSTVGYGDYVPHTPLGQAAGILLIL
SGASFVTAYFATLSAAAFSRQHRYIEGKVAYKGRDHIILIGWNEKTNRLLKDLQLAAPSKTVVLIDESLTEGPLIENVHF
IRGHAADDGTLKRANITEAESVMITADQYKSETDADMLSVLTLLSVKGLNPLAYCIVEILTDRFVTNAERAGANQIIGTS
EFISRAMLQHYQVKLRPSKQQNGIKLTLDQHVELLAVPDELKGAAYKTCVLYFLDHNTTIIGIQKKEGPMLSPPLTYKVL
ETDQFLAI