TCDB is operated by the Saier Lab Bioinformatics Group
>Q7A651|Q7A651_STAAN IsdF protein - Staphylococcus aureus (strain N315).
MMIKNKKKLLFLCLLVILIATAYISFVTGTIKLSFNDLFTKFTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGALLQA
ALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLSFIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVL
EILTQNPLMKIPQGLTMKIWSDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
AIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLICQSQRN
RI