TCDB is operated by the Saier Lab Bioinformatics Group
>Q7AUQ4|Q7AUQ4_ENTFA Accessory protein - Enterococcus faecalis subsp. liquefaciens.
MILKKLTKKQQISLTIIGCLVGVLLISATLIYKLNATEPKEEESYQIIKVKKSDPLVLKGIVQPKTTSYLNFDQSLGKIN
TISVKNGQEINENDVVATYQNTTVEDQAEEQTQSLEKLNLAVTNAQINLDNATQKQQELENRLSVAKNEQTTIINKKMDD
EMKKAEKAESDSKIETIQQALDAQKEAVLQAKQALDAANVDLSSANNTIEQTKKKITTTVTAPFKGIVYINDKGKVDATI
PYATIVSPETVIKGSVTEYDYNKVKVGQPVTISQINEEKATDGIISEINALPEDMAVSPQNTSSTKNSTISTFSFIISPK
EPIHYGYNVQISVPMNNLELAKKNTVKENNNEVFVFIYRDGKVVKQKIEVKEDNDKYVVKTGLKENDSIIENPDTSLKDG
QKVTVKQ