TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7AYJ3|Q7AYJ3_TREMA MspA protein OS=Treponema maltophilum GN=mspA PE=4 SV=1
MKKALVFFVALAMIGSVFAAEPAAEAKVAEFSGNAAVTFGFDLDTVKAGFKNTTEADLKFNLMNGGDKSTTGNGVWGELK
LVVNALQIRATADVSDGHTFAIQTKKDNDGEDTIFVEIDTAKLHFNDLYVGITSGDFRYGGSFWYPNALNYKDSKEDEKY
TRSRAAKLGYDQGLVLGYEKKDLFKVELAARSKKDTTKKVEKVELVHLSAGAKIKEKEYYKTEPAAVTGDTAQDIFNDGT
LVSVTADPKVKTLNAEGAYYKPVMKDDETNYWTNKFALGLYGEVTPIKDLRIGVGAAYVLGQLGAAASEDDKTNDISVFA
GVDYRFNFNEDFFIQPTVTYNFYNDYKVASKNYAIETNKMNAGLRFGFAKSKSDSENESLLYTFFGQEKLFYETTKNDKG
DQILLPGVSVFGSFNFKENAMKTELPVMLTFYSGELVQNLKAYALFGANLGPDAGKGTAVAMSDAVYKGIIEKKGMQAGL
AASYDVKVNDAVTIVPAAGVLWTHGSQASGNDKMSADEVAVSLKADVKGLVSNTTFTAFWEKASFGKGAASVGGTKTSVD
AVKKGVIGLKAKIAL