TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|Q7BW13 3.A.1.16.2 Integral membrane protein
MVRTPVPLYLRWAVSILSVLAFLAIWQIAAASGFLGKTFPGSLRTLQDLFGWLSDPFFDNGPNDLGIGWNLLISLRRVAI
GYLLATVVAIPLGIAIGMSALASSIFSPFVQLLKPVSPLAWLPIGLFLFRDSELTGVFVILISSLWPTLINTAFGVANVN
PDFLKVSQSLGASRWRTILKVILPAALPSIIAGMRISMGIAWLVIVAAEMLLGTGIGYFIWNEWNNLSLPNIFSAIIIIG
IVGILLDQGFRFLENQFSYAGNR