TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7CXG0|Q7CXG0_AGRT5 ABC transporter, substrate binding protein (Proline/glycine betaine) OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=Atu2281 PE=4 SV=2
MFANRSRCLALAAAISSMTFSAAVAAEPASCGTVRFSDVGWTDITATTATATVLLKSLGYETDVKLLSVPVTYTSLKNKD
IDVFLGNWMPTMEGDIAPYRDDKSVETLRENLTGAKYTLATNAKGAELGIKDFKDIAAHSSELGGKIYGIEPGNDGNRLI
LDMVAKDSFGLKSFEVVESSEQGMLSQVARAEKSGEPIVFLGWEPHPMNANFKLTYLTGGDEVFGPNFGGATIYTNVRKG
YVEECPNVGAFLKNLQFSLPMENEIMGKILNDGLEGEAAATAWLKANPAAIEPWFANVKTKDGSADALPAVKKALGL