TCDB is operated by the Saier Lab Bioinformatics Group
>Q7KVW5|KCNN3_DROME Small conductance calcium-activated potassium channel protein - Drosophila melanogaster (Fruit fly).
MSIQKLNDTTNSGYVSSEETDSLLVSSSNPSKGGGRTALLRQVKSNSTNGPTTGASTSSSGSVSGGGGGSGSGGGSASGS
AAGASKPTLMRQDRTSTYLTSPQQSQHARMGSEESMRGGASGAAGHDEDVEQGLVRSSIVPDIEVHEEDQEQHSQQLNAT
TMATMTNNQQQQQPTISIMNLSLKPGDSHSHSSSPGSHPNLGTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLID
RSASRDSVKSAFQQGNLSGSMAICISNSALPQQQQLQQQYHLQQQQQQHYQLQQHHLHQQQLQQSQQQVPPVLITSSPTN
GSRIIRQSSQPESSSTAICCGPHSACVGHAHSHSHTVPNVSLKQLRESSGDGIAGIAADSLRINGGMRPFKQLRKPASTL
SIPGSMKTPSIANREQISSGCNEEAAEALVGIHSDYPRYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRK
RISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTW
QRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGA
LNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGR
GITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQ
RKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCL
TQHQERIEQRRNFLHPDTAAVAPIQAPTPQSMFNAAPMLFPHSS