TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7UPC8|Q7UPC8_RHOBA Hypothetical membrane protein OS=Rhodopirellula baltica (strain SH1) GN=RB7023 PE=4 SV=1
MKRSAQIARRLLPMVLVIVGVCGLVSGVGVELAGDWLNVGRDAGPLAFVVLGTLAMCLFVPKTFVSIAAGSVFGLMVGGP
TLAVTAVVSAWVNYHLGRWSLGHSSIDVEAEGTDASWREALRIIRSGAREANLGTHLLVRLSPIPTTIISYTMGASRARQ
VPYLAAALLAAGPQLLWVHCGAMATETMSTVAEAGVSGATGSSLTRWLGLVTSVIAAVLLSVLVPRHIWRQRARGLAAAE
LAADQNA