TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7USX5|Q7USX5_RHOBA Putative uncharacterized protein OS=Rhodopirellula baltica (strain SH1) GN=RB4248 PE=4 SV=1
MSPADPAEDQPTGKSQPLWKRIFRVALPIVLLVGCWFAFQTSGEDLRAMHQRLGWIAPVVTVPLHAVIAAAPVPSDVIVI
ANGGLYPYPFAVLLGWLGWFLGSTLEFLTIRLLTGVESAEDARRKMPTWLSRWPAGSPWFLVLGRQIPGVGAHLTAGVAA
AGGVSLKRYLLWTAVAIVPGALLLSAIGAHLLGSV