TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7VJ34|Q7VJ34_HELHP Nickel transport system permease protein NikB OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nikB PE=3 SV=1
MAYIIHSGLPATPELIEEITHNFGLDKPLLEQYVTWLCNALKLDFGISYMNGRSVSTDFLYFLPNTLILVACGFGLTFLC
SVPLGVVSVYYHNKLPDFFIRFFCFVGVSMPNFWLAFLLILFFSVYLGWLPAVGMEGAQSFILPSISIALMSICINARLI
RANMLEMQKERHIIYAKMRGVNGWRLHIKHIFYNAFLPILTAMGMHIGELIGGALVIESVFALPGIGLYSIQGIANHDYP
VIQCFIVVLSFCFVLCNGMVDILYGLLDPRIRKQMEDIQSISKEKMQSFESIQKEGGV