TCDB is operated by the Saier Lab Bioinformatics Group
>Q7WWR0|Q7WWR0_LACAC Substrate-binding protein MsmE - Lactobacillus acidophilus.
MKKWKLGVAAIATVAALSLTGCSNNSQSGSSNNKNVTMWVHFSNTDPEGKALQKNINDFNKENKHGYKAKVQYIPRSGSG
GGYEDKINAALNSGSLPDVLTLDAPNTAAYAHSKIIQPIDKYITNKDDILPTIIKQGTYKGKLYAAGYSESSIGFYYNKK
MFKEAGIKDSEIATLQHPWTWTQFKDICKRLKNHFHEPAINMNLNDHSEMALYSLAPFVWSAGGSITNPAGTKAVGYFNS
KQTTSAFQLIQDMVKDGYTTISPKDKGFETGKYAMMMTGTWEVQTLQNQYKNLQWGVMPYPVSPATHKEVSPTGSWQYAM
SSAAKNKKAAGALINFLMSKKCMYRSDMANTVLPARKSVSKMMMPKVNEQMRFFIKQNQTTGHARPVLVNYPQVTRTFAD
TVQNVTLYKKNPNVQKVMNEQAKVIQKYLEK