TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7Z7J7|LHPL4_HUMAN LHFPL tetraspan subfamily member 4 protein OS=Homo sapiens OX=9606 GN=LHFPL4 PE=2 SV=1
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGS
FTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCG
AKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCP
VAHSQGP