TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7ZWP6|Q7ZWP6_XENLA MGC53161 protein OS=Xenopus laevis GN=stx7 PE=2 SV=1
MSYNTGQESSQLAQIISGNIQKITQSSSEIQRIVVHQLGTAQDTAELRNHLQEKIQYTHKIAKDTERCLKDYASLPSESD
QRQRKLQKDRLVNEFSSALGNFQKVQRQAAEKEKEFVARVRAGSRVSGGFPDDNQKEGSLLTWENEAQPQATLQEEAITE
DDLYLIEERETAIRQLEEDIQGINEIFKDLGMMVHEQGEMIDSIEANVENAEVHVQQANQQLATAAEYQRKSRRKICIII
AVLVVAATVIGLIIWGTVK