TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q838P8 Membrane protein, putative - Enterococcus faecalis (Streptococcus faecalis).
MKKSSKVALIFAFLVSIFVPVAAFADEIGDVVAPTGIMALVVIIPLIVVLVLLFMKVDMIIAGLIGGVLAMLIGGIGLEE
ANKQMLEAIPMMLGITVPIINSAVAMAVFKAGSYSAALTLAKRGTKGKVEYVSAFIVILLAAATYMSGIGGGSAMVIAPL
AFAAVGVVPELIAAMSLAAAVSFTTSPASLESSIVSKLGDISVGSYVSTMRPYWLFFVALAIVLAFWGTKHRNVGFKESA
DDEFDKKSNGELFKITLPAIFLLFAVIFGPIVNDLIGFAFFTPLVYMILTLVLIFLCTDFSMNKSVEAMVDGSTYILTRL
FQVGIFLAFINVIAQTGTFAVIAGVAENAPAFIVVPVAILTGILIGIPAGAYVGSVLTLVLPVAVSLNFPPLALGFVAMG
VGLGSQMSFVNITMQALSSGFQIPILDVVKGNVKWLSIASVLLLVIGLIFG