TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q839D3|Q839D3_ENTFA Cobalt transport family protein OS=Enterococcus faecalis GN=EF_0239 PE=4 SV=1
MMNKLIFGRYIPGDSFIHRLDPRAKLLASFYFIGIIFLANNWQSYVLIAAFTAFAISLSKISARFFIRGVRPLLWLILFT
VALQTLFTQGGEVYFQWGIISITQFGVTNGLFIFCRFVLIIFMSTLLTLTTAPLELSDAIEYLLRPLHVVKFPVHEVSLM
LSIALRFVPTLMDETEKIMNAQRARGVDFGEGNLLQKMKAIVPLLIPLFVSSFNRAEDLATAMEARGYQGGEGRTKYRIL
HWHLRDTIVMFGFVLLTIGLFVLRT