TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q84FB8|Q84FB8_MYXXA Adventurous gliding motility protein R OS=Myxococcus xanthus GN=aglR PE=3 SV=1
MDLASVTNLTVLANVGGPQRGFFEEIAMRWEAGQWGMYPIAACLIVALAIMVERSIILFGKASINKEAFLRGLKKHIYAG
DLDKAINYVAGQKSTPLTNVIKAGLMNVPKGNDEVQAALDEASLRETPKIEARTGYLAMLGNAAMLAGLLGTVSGLIACF
EAVANVNPADKAAILAIGISEAMNCTGFGLLTAIPALISFSVLTGRTQSLINDINETSVSVLNLIVANKDKFKNLNVPTA
ARDEE