TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q87WH3|Q87WH3_PSESM Glycine betaine/choline OpuC ABC transporter, periplasmic substrate-binding protein OS=Pseudomonas syringae pv. tomato GN=PSPTO4577 PE=4 SV=1
MKKICLFLGFALLFPAFAQAAEKPLLRVGARVFTEQTMLAELTAQYLRTKNYDVQITGGLGSNLARSAQESGQLDLLWEY
TGVSLVAYNHIDEKLDSAQTYARVKEVDAKKGLVWLSPSKFNNTYALALPQKIADKYPQVNTMTDLTKVLKDEAKEGHLV
ALDTEFANRSDGLVGMVKHYGMNLGRENTRQMDSGLVYTALQNGQVFAGLVYTTDGRLNAFKLKVLEDDKHYFPDYTAAP
VIRQEYLDKHPDIATLLKPLAELLDNQTMIDLNARVDVGHESPSSVAADFLRQHPLN