TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q87WH4|Q87WH4_PSESM Glycine betaine/choline OpuC ABC transporter, permease protein OS=Pseudomonas syringae pv. tomato GN=PSPTO4576 PE=3 SV=1
MSFLSAFSHLDWAQVLQLTWQHITLVGIAVTLAIVVGVPLGVLMTRFPALAGPLQASATVLLTVPSIALFGLLLPFYSKF
GQGLGPMPAITAVFLYSLLPIMRNTYLALTGVEPGIREAAKGIGMTFGQRLRMVELPIAVPVILAGVRTAVVMNIGVMTI
AATIGAGGLGVLILASISRSDMSMLIVGAVLVSILAIIADLLLQWLQRTLTPKGLLK