TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8C0T0|XKR8_MOUSE XK-related protein 8 OS=Mus musculus GN=Xkr8 PE=2 SV=1
MPLSVHHHVALDVVVGLVSILSFLLDLVADLWAVVQYVLLGRYLWAALVLVLLGQASVLLQLFSWLWLTADPTELHHSQL
SRPFLALLHLLQLGYLYRCLHGMHQGLSMCYQEMPSECDLAYADFLSLDISMLKLFESFLEATPQLTLVLAIVLQNGQAE
YYQWFGISSSFLGISWALLDYHRSLRTCLPSKPRLGRSSSAIYFLWNLLLLGPRICAIALFSAVFPYYVALHFFSLWLVL
LFWIWLQGTNFMPDSKGEWLYRVTMALILYFSWFNVSGGRTRGRAVIHLIFIFSDSVLLVTTSWVTHGTWLPSGISLLMW
VTIGGACFFLGLALRVIYYLWLHPSCSWDPDLVDGTLGLLSPHRPPKLIYNRRATLLAENFFAKAKARAVLTEEVQLNGV
L