TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8CX78|Q8CX78_OCEIH Acriflavine resistance protein (Cation efflux system) OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2940 PE=4 SV=1
MKLVNTSVKRPIGVIMVVLAIIALGVVSLRNLAVDLFPEIDLPVAVVATSYQDAAPEDVENLISRPIESSVSSVEGIDTV
QSQSQSGSSMVMMMFQNGTDLDQALLDVREQVDQVKGMLPDQAGDPNILRFSPEAMPVVYLGLTGGDTAELTEIANEQIV
PYFERQAGVASVSVEGGLEREIQVELDEARMSQYGITSQSVMQAISDSNNSSSVGTVEQGNQDLQLRVTGEFESINDIEE
TRIQTEAGDVIQVSDVATVNDDFKDRSSDTLVDGEPAIVLSVMKQTDANTVEVASNIESSMEDLKGDLPEGANLKTVIDT
SDFIEMSIDSVINNILIGGAIAFLILLLFLKSFRATIVIGLSIPIALISTFTLMYFTGQTLNVLTLGGLALGIGMMVDSS
IIILENIYSYKRRGYNLFDSATKGASELAPAVIASTTTTLVVFLPIIFVEGLSADLFAPLALAVSFSLIASLVVAITLVP
MLSSKLLSKAMEDKGRRYWFDRFLDWLRELYSGGLSRVLKFRKTTVLVVILAIAGSLALIPRMGAEFMPSSDQGQAQITV
ETAPGSSLAYTQTISDQVNEVLSQYDDVIETSYVTVGATGFESGNQASYTIQMTPVAEREQTTTQIVQNLDDELQHIAGA
EIVASAMDGGMQMGDPITIQLNGQEHEVLSDLSEEVLQEINQVDGVFNASSAASEGIPQMTITVDDAVARSYGLTSDQVS
SQIRMKFSGQVVTQYREDGQEMDVTLVYPQEERNTINDLQDMSIQSPSGAKVPLDELVELEQEQGPESLLRENQQPQMNI
TSDVVDRDLGSVVSDVESALDNIHFPEGYSYSIGGQAADMEEAFAELAIALVFSIFLVYAVMAIQFENLLQPFIIMFALP
TTVIGVIGGLWITGLSLSIPAFIGVIMLAGIVVNNSIVLVDYINILRRRGTDRIESIIEAGKSRLRPILMTTLTTILAMV
PLGLGIGEGAELQQPLAVTIIFGLTVSSFFTLLFVPVIYLMFDNMTTKFRRKKKEA