TCDB is operated by the Saier Lab Bioinformatics Group
>Q8DQ41|Q8DQ41_STRR6 Competence protein - Streptococcus pneumoniae (strain ATCC BAA-255 / R6).
MEAIIEKIKEYKIIVICTGLGLLVGGFFLLKPAPQTPVKETNLQAEVAAVSKDLVSEKEVNKEEKEEPLEQDLITVDVKG
AVKSPGIYDLPVGSRVNDAVQKAGGLTEQADSKSLNLAQKVSDEALVYVPTKGEEAVSQQTGLGTASSISKEKKVNLNKA
SLEELKQVKGLGGKRAQDIIDHREANGKFKSVDELKKVSGIGGKTIEKLKDYVTVD