TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8E9J0|Q8E9J0_SHEON Chemotaxis motA protein OS=Shewanella oneidensis GN=motA PE=3 SV=1
MSFIGVIVALVFILVGNLIEGGHPSALLDLPAFMIVIGGTIGATVAQFPFSVIIASMKRFKWLIFPLRTDLNERAEFLIE
IAGDVRKGGLLSIEDKIDQIDDPFLHKGLELLVDGYEKDNIVEILEKEIEFEQHGIEQTVKVYEAMGGYCPTMGIVGAVF
GLIHAMGLLDAPDKLGGAIAVAFIATIYGVAAANIIFLPFGNRYKAFAHQLSLFKEMTLTGITGIADGESPQRLQAQLNP
YLEH