TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F192|Q8F192_LEPIN Biopolymer transport protein TolQ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tolQ PE=3 SV=1
MKFFSIKKEFKWVFVALILSGMISISTSVIFAQDKTPEQTQTTPTTEPSKTETPASTKADKSWGFVDLFLLGGWTMYPLA
LSSIVALGIIFERIYFLATAKLLPKGYNIDLGETMDAKGLDAVRGFLDERKDYKITQVLAGGIEVSSGDAEIFAKGVERE
AAEVITVLERGLVILAAVSTIAPLIGFLGTVSGMINAFDAIANADQVNAKVVAGGIKEALITTAAGLIVAIPAMTFHQYL
TSRIDGFTSEIEEAANRIYKEFLKRNSQKV