TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F225|Q8F225_LEPIN Polysaccharide biosynthesis protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_2953 PE=4 SV=1
MYNLSGKIQKVSDLWLQFRQSGMFKSSLFVSISKAVSSLLNLVFMVYSVNILTKSENGLFQYYAGFIPVLLAIAEFGLPT
ALVKFLAPVTTDKQKIGDLLSSSLLIKLGALVALTLISLIASILLKESTLVVSLLVLGSFILSFNSFFESIFICFGNYIS
LSFWNPLPNLIRFVVLYSADRFTERALGHLDILAIFTISPIFVLILFFFVFPRKQLNWSGEKNGIREMTYTLTSFNGYAF
LASIFAMISDRMEIFFLKWYYSQESAAVYGTALQLFSGFVILFSVINSLIYPKLSRLVDSDEFPKFLWKSVMLSVGMAVL
LSPGFFLAEWILNLLFRGKYADSIGVFQILYPNYMLQLVFSPLGIALFALGQPRMLAFLALLRLICGVVLANLLIPEYGP
TGAASSYFLGQIVSWLILTGYFLAFFRR