TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F6Y8|Q8F6Y8_LEPIN Fatty acid transport protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_1161 PE=4 SV=2
MQKTKIAFRFYFKILFFICIGSISVNSLFGVGVFQPSHNARYAGMAGVNLAIGGSPMDIATNPANLVLNSKGGLEFGIGL
PYIRSQYKDRLSDTNPETEYHNSQNYNILAPLPYFGLTLPLTDRLSYGIGIYVPGGGSGQVNGILRLTPNAQSLRDWSGV
DIPGPIGDSKKIKEDLSTTFYVVKATNALAYRFGNLSVGMGIEMIYSKQIANQKFYDITHTLEIPGQGFDYRSKNAYSMG
GIFGFSYAFTELFRIAYSYQTRSILPLDGGMQIGIGDVNNYRRTGVSATFNLPEKHGLGFSFGNESLKIGLDFLYYNYNS
YDQTFKQRLEDPWFPTFLGKTNTITQNIAYHDAWAGAIGIEYKLDSFVYRGGYRYNTGVVRSEGISALQAGIMVQQLATL
GLSFLSGKWSFDLAINYLFAKKVTADPGNNWAVLHSAFGPNDIRILNYSQSLQSDVPAILFGASYKFD