TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8IR18|Q8IR18_DROME CG32579, isoform A OS=Drosophila melanogaster GN=CG32579 PE=2 SV=1
MASAEQRTEVDALMMGPISKLSMLLTVVSILWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKS
AHAGEKRILERGVYSNAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQ
LAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVSRTLCIAYVASIFPIE
TLIICATLACFYGTIVFFVDSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNIIACALYIPLY
LATAIIALYIVGIVLLIIYYTYCHPNTVRTYF