TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2
MERTEESAPGPGGADAASERRGLRCLLLPGFLEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAV
INVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMI
FIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRL
HQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRV
GNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILR
GTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWKRACQQAQVHANLKVNVA
LNSAVSHEPAHPVCPESHGEIMMTDLEKKDETQLDQPMNQQQALPIRPKDSNKLSGKQLALRRGLLLLGVVLVLVGGILV
RVYIRIE