TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KGE5|Q8KGE5_CHLTE Putative uncharacterized protein OS=Chlorobium tepidum GN=CT0023 PE=4 SV=1
MPPKEMTMLDNDRKKDKFSEQFGGTVRALSEYLGIGIQIAASFALFVFLGYWSDSKLGTSPLLLLAGVLVGMVGMALVLM
KTIRQADREHDRLHQHTRNHEKDRRT