TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KN17|Q8KN17_9ACTO Putative sugar transporter integral membrane protein OS=Streptomyces sp. 139 GN=ste4 PE=3 SV=1
MKRSLFGRVWPNATALVVFVACLFPVYWMFATALKPTGDIIAEDPVWFPTNVTFEHFATAVDADHFWTYVRNSLTVTCLA
VLFSLGIALAGSFALARMRFKGRRGFIVGFMLAQMAPWEVMVIAIYMIVRDASMLNSLVPLTAFYMMMILPFTILTLRGF
VAAVPKELEESAMVDGCTRGQAFRRVILPLLAPGLMSTSMFGFITAWNEFPLVLVLSKESGGAQTLPLWLSSFQTQFGDD
WGATMAASSLFAVPILILFVFLQRRAVSGLTAGAVKG